| Edit |   |
| Antigenic Specificity | FAM124A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FAM124A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM124A. This antibody reacts with human. The FAM124A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FAM124A(family with sequence similarity 124A) The peptide sequence was selected from the middle region of FAM124A. Peptide sequence VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT. |
| Other Names | family with sequence similarity 124A, FLJ30707, hypothetical protein LOC220108 |
| Gene, Accession # | FAM124A, Gene ID: 220108, Accession: Q86V42, SwissProt: Q86V42 |
| Catalog # | NBP1-57657 |
| Price | |
| Order / More Info | FAM124A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |