| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAM125A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM125A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM125A. This antibody reacts with human. The FAM125A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FAM125A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ISCTVEGAPASFGKSFAQKSGYFLCLSSLGSLENPQENVVADIQIVVDKSPLPLGFSPVCDPMDSKASVSKKKRMCVKLLPL |
|---|
| Other Names | CFBP, CIN85/CD2AP family binding protein, CIN85/CD2AP family-binding protein, ESCRT-I complex subunit MVB12A, family with sequence similarity 125, member A, FLJ32495, multivesicular body subunit 12A, Protein FAM125A |
|---|
| Gene, Accession # | MVB12A, Gene ID: 93343 |
|---|
| Catalog # | NBP1-91883 |
|---|
| Price | |
|---|
| Order / More Info | FAM125A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|