| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD2F-10/SLAMF9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD2F-10/SLAMF9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD2F-10/SLAMF9. This antibody reacts with human. The CD2F-10/SLAMF9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD2F-10/SLAMF9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAF |
|---|
| Other Names | CD2 family member 10, CD2F10, CD2F-10MGC88194, CD84 homolog 1, CD84H1, CD84-H1cluster of differentiation 2 antigen family member 10, cluster of differentiation 84 homolog 1, SF2001, signaling lymphocytic activation molecule family member 2001, signaling lymphocytic activation molecule family member 9, SLAM family member 9 |
|---|
| Gene, Accession # | SLAMF9, Gene ID: 89886 |
|---|
| Catalog # | NBP1-84593 |
|---|
| Price | |
|---|
| Order / More Info | CD2F-10/SLAMF9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|