| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD3 gamma |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CD3 gamma Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD3 gamma. This antibody reacts with human. The CD3 gamma Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CD3 gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN |
|---|
| Other Names | CD3g antigen, CD3g antigen, gamma polypeptide (TiT3 complex), CD3g molecule, epsilon (CD3-TCR complex), CD3g molecule, gamma (CD3-TCR complex), CD3-GAMMA, FLJ17620, FLJ17664, FLJ79544, FLJ94613, MGC138597, T3G, T-cell antigen receptor complex, gamma subunit of T3, T-cell receptor T3 gamma chain, T-cell surface glycoprotein CD3 gamma chain |
|---|
| Gene, Accession # | CD3G, Gene ID: 917 |
|---|
| Catalog # | NBP2-32636 |
|---|
| Price | |
|---|
| Order / More Info | CD3 gamma Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|