| 产品详情 |
| Edit |   |
| Antigenic Specificity | NUBP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NUBP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUBP1. This antibody reacts with human. The NUBP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human NUBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS |
| Other Names | cytosolic Fe-S cluster assembly factor NUBP1, MGC117406, MGC130053, NBP 1, NBP1, NBPMGC130052, nucleotide binding protein (e.coli MinD like), nucleotide binding protein 1 (E.coli MinD like), nucleotide binding protein 1 (MinD homolog, E. coli), Nucleotide-binding protein 1 |
| Gene, Accession # | NUBP1, Gene ID: 4682 |
| Catalog # | NBP1-92205 |
| Price | |
| Order / More Info | NUBP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|