| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NUBP1 |
|---|
| Clone | 2B11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUBP1 Antibody (2B11) from Novus Biologicals is a mouse monoclonal antibody to NUBP1. This antibody reacts with human. The NUBP1 Antibody (2B11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | NUBP1 (NP_002475.1 222 a.a. - 320 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS |
|---|
| Other Names | cytosolic Fe-S cluster assembly factor NUBP1, MGC117406, MGC130053, NBP 1, NBP1, NBPMGC130052, nucleotide binding protein (e.coli MinD like), nucleotide binding protein 1 (E.coli MinD like), nucleotide binding protein 1 (MinD homolog, E. coli), Nucleotide-binding protein 1 |
|---|
| Gene, Accession # | NUBP1, Gene ID: 4682, Accession: NP_002475, SwissProt: NP_002475 |
|---|
| Catalog # | H00004682-M03 |
|---|
| Price | |
|---|
| Order / More Info | NUBP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|