| 产品详情 |
| Edit |   |
| Antigenic Specificity | NUBP2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NUBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUBP2. This antibody reacts with human. The NUBP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NUBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: STISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWAPVF |
| Other Names | CFD1C447E6.1 (nucleotide binding protein 1 (E.coli MinD like) ), cytosolic Fe-S cluster assembly factor NUBP2, homolog of yeast cytosolic Fe-S cluster deficient 1, NBP 2, NUBP1, nucleotide binding protein 2 (E.coli MinD like), nucleotide binding protein 2 (MinD homolog, E. coli), Nucleotide-binding protein 2 |
| Gene, Accession # | NUBP2, Gene ID: 10101 |
| Catalog # | NBP1-84533 |
| Price | |
| Order / More Info | NUBP2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 30765471 |
| 产品资料 |
|
|