| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Guanylyl Cyclase beta 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 50 ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Guanylyl Cyclase beta 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Guanylyl Cyclase beta 1. This antibody reacts with human, mouse. The Guanylyl Cyclase beta 1 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: beta-1 |
|---|
| Immunogen | Synthetic peptides corresponding to GUCY1B3(guanylate cyclase 1, soluble, beta 3) The peptide sequence was selected from the N terminal of GUCY1B3 (NP_000848). Peptide sequence LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV. |
|---|
| Other Names | EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit |
|---|
| Gene, Accession # | GUCY1B3, Gene ID: 2983, Accession: Q02153, SwissProt: Q02153 |
|---|
| Catalog # | NBP1-58869 |
|---|
| Price | |
|---|
| Order / More Info | Guanylyl Cyclase beta 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24050894, 28894114 |
|---|
| 产品资料 |
|
|