| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GUCY2C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25979109). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GUCY2C Antibody from Novus Biologicals is a rabbit polyclonal antibody to GUCY2C. This antibody reacts with human. The GUCY2C Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GUCY2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD |
|---|
| Other Names | EC 4.6.1, GC-C, guanylate cyclase 2C (heat stable enterotoxin receptor), Guanylyl cyclase C, GUC2CEC 4.6.1.2, heat-stable enterotoxin receptor, hSTAR, Intestinal guanylate cyclase, STARSTA receptor |
|---|
| Gene, Accession # | GUCY2C, Gene ID: 2984 |
|---|
| Catalog # | NBP1-81788 |
|---|
| Price | |
|---|
| Order / More Info | GUCY2C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25979109 |
|---|
| 产品资料 |
|
|