| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHRNB3 |
|---|
| Clone | 3G6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHRNB3 Antibody (3G6) from Novus Biologicals is a mouse monoclonal antibody to CHRNB3. This antibody reacts with human. The CHRNB3 Antibody (3G6) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | CHRNB3 (NP_000740 128 a.a. - 223 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFI |
|---|
| Other Names | acetylcholine receptor, neuronal nicotinic, beta-3 subunit, cholinergic receptor, nicotinic, beta 3, cholinergic receptor, nicotinic, beta polypeptide 3, neuronal acetylcholine receptor subunit beta-3 |
|---|
| Gene, Accession # | CHRNB3, Gene ID: 1142, Accession: NP_000740, SwissProt: NP_000740 |
|---|
| Catalog # | H00001142-M01 |
|---|
| Price | |
|---|
| Order / More Info | CHRNB3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|