| Edit |   |
|---|
| Antigenic Specificity | Pbx3 |
|---|
| Clone | 1A9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Pbx3 Antibody (1A9) from Novus Biologicals is a mouse monoclonal antibody to Pbx3. This antibody reacts with human. The Pbx3 Antibody (1A9) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PBX3 (NP_006186 342 a.a. - 434 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN |
|---|
| Other Names | Homeobox protein PBX3, pre-B-cell leukemia homeobox 3, pre-B-cell leukemia transcription factor 3 |
|---|
| Gene, Accession # | PBX3, Gene ID: 5090, Accession: NP_006186, SwissProt: NP_006186 |
|---|
| Catalog # | H00005090-M01 |
|---|
| Price | |
|---|
| Order / More Info | Pbx3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27273830 |
|---|