| 产品详情 |
| Edit |   |
| Antigenic Specificity | UBR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UBR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBR1. This antibody reacts with human. The UBR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UBR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: APEEEVTFDFYHKASRLGSSAMNIQMLLEKLKGIPQLEGQKDMITWILQMFDTVKRLREKSCLIVATTSGSESIKNDE |
| Other Names | E3 ubiquitin-protein ligase UBR1, E3a ligase, EC 6.3.2.-, JBS, MGC142065, MGC142067, N-recognin-1, ubiquitin ligase E3 alpha-I, ubiquitin protein ligase E3 component n-recognin 1, ubiquitin-protein ligase E3-alpha, Ubiquitin-protein ligase E3-alpha-1, Ubiquitin-protein ligase E3-alpha-I |
| Gene, Accession # | UBR1, Gene ID: 197131 |
| Catalog # | NBP1-86253 |
| Price | |
| Order / More Info | UBR1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|