| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBR2. This antibody reacts with human. The UBR2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UBR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QPNLTQWIRTISQQIKALQFLRKEESTPNNASTKNSENVDELQLPEGFRPDFRPKIPYSESIKEMLTTFGTATYKVGLKVHPN |
|---|
| Other Names | bA49A4.1, C6orf133MGC71112, chromosome 6 open reading frame 133, dJ242G1.1, dJ392M17.3, DKFZp686C08114, E3 ubiquitin-protein ligase UBR2, EC 6.3.2.-, KIAA0349FLJ36357, N-recognin-2, RP3-392M17.3, ubiquitin protein ligase E3 component n-recognin 2, Ubiquitin-protein ligase E3-alpha-2, Ubiquitin-protein ligase E3-alpha-II |
|---|
| Gene, Accession # | UBR2, Gene ID: 23304 |
|---|
| Catalog # | NBP1-88760 |
|---|
| Price | |
|---|
| Order / More Info | UBR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|