| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBR5/EDD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBR5/EDD Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBR5/EDD. This antibody reacts with human. The UBR5/EDD Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human UBR5/EDD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI |
|---|
| Other Names | DD5, E3 ubiquitin protein ligase, HECT domain containing, 1, E3 ubiquitin-protein ligase, HECT domain-containing 1, EC 6.3.2, EC 6.3.2.-, EDD1E3 ubiquitin-protein ligase UBR5, EDDE3 identified by differential display, hHYD, HYDFLJ11310, Hyperplastic discs protein homolog, KIAA0896MGC57263, progestin induced protein, Progestin-induced protein, ubiquitin protein ligase E3 component n-recognin 5, ubiquitin-protein ligase |
|---|
| Gene, Accession # | UBR5, Gene ID: 51366 |
|---|
| Catalog # | NBP2-58579 |
|---|
| Price | |
|---|
| Order / More Info | UBR5/EDD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|