| Edit |   |
| Antigenic Specificity | UBTD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UBTD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBTD1. This antibody reacts with rat. The UBTD1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Ubtd1 - C-terminal region. Peptide sequence LSASLPDTVGQLKRQLHSQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKD. |
| Other Names | FLJ11807, ubiquitin domain containing 1, ubiquitin domain-containing protein 1 |
| Gene, Accession # | UBTD1, Gene ID: 80019, Accession: NP_001013171 |
| Catalog # | NBP1-98480 |
| Price | |
| Order / More Info | UBTD1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |