| Edit |   |
|---|
| Antigenic Specificity | NTS1/NTSR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 50ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NTS1/NTSR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NTS1/NTSR1. This antibody reacts with human. The NTS1/NTSR1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NTSR1(neurotensin receptor 1 (high affinity)) The peptide sequence was selected from the N terminal of NTSR1. Peptide sequence FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT. |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | NTSR1, Gene ID: 4923, Accession: P30989, SwissProt: P30989 |
|---|
| Catalog # | NBP1-60045 |
|---|
| Price | |
|---|
| Order / More Info | NTS1/NTSR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|