| Edit |   |
| Antigenic Specificity | Ras-GAP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ras-GAP Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ras-GAP. This antibody reacts with mouse. The Ras-GAP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the C terminal of Rasa1. Immunizing peptide sequence SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT. |
| Other Names | n/a |
| Gene, Accession # | RASA1, Gene ID: 5921, Accession: Q91YX7 |
| Catalog # | NBP1-74143-20ul |
| Price | |
| Order / More Info | Ras-GAP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |