| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EME2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EME2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EME2. This antibody reacts with human. The EME2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human EME2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS |
|---|
| Other Names | EC 3.1.22, Essential Meiotic Endonuclease 1 Homolog 2, Essential Meiotic Endonuclease 1 Homolog 2 (S. Pombe), Essential Meiotic Structure-Specific Endonuclease Subunit 2, gs125, Homolog Of Yeast EME1 Endonuclease 2, Probable Crossover Junction Endonuclease EME2, SLX2 Structure-Specific Endonuclease Subunit Homolog B, SLX2 Structure-Specific Endonuclease Subunit Homolog B (S. Cerevisiae), SLX2B |
|---|
| Gene, Accession # | EME2, Gene ID: 197342, Accession: A4GXA9, SwissProt: A4GXA9 |
|---|
| Catalog # | NBP2-30885 |
|---|
| Price | |
|---|
| Order / More Info | EME2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|