| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EMG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EMG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EMG1. This antibody reacts with human. The EMG1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human EMG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW |
|---|
| Other Names | 18S rRNA (pseudouridine-N1-)-methyltransferase NEP1, BWCNS, C2F18S rRNA Psi1248 methyltransferase, EMG1 nucleolar protein homolog (S. cerevisiae), essential for mitotic growth 1, FLJ60792, Grcc2f, NEP1EC 2.1.1.-, Nucleolar protein EMG1 homolog, probable ribosome biogenesis protein NEP1, Protein C2f, Ribosome biogenesis protein NEP1 |
|---|
| Gene, Accession # | EMG1, Gene ID: 10436 |
|---|
| Catalog # | NBP2-54688 |
|---|
| Price | |
|---|
| Order / More Info | EMG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|