| Edit |   |
| Antigenic Specificity | GMPPA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. IHC-P reported in scientific literature (PMID: 30072579). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GMPPA Antibody from Novus Biologicals is a rabbit polyclonal antibody to GMPPA. This antibody reacts with human. The GMPPA Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GMPPA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL |
| Other Names | EC 2.7.7, EC 2.7.7.13, GDP-mannose pyrophosphorylase Amannose-1-phosphate guanyltransferase alpha, GTP-mannose-1-phosphate guanylyltransferase alpha, mannose-1-phosphate guanylyltransferase (GDP) |
| Gene, Accession # | GMPPA, Gene ID: 29926, Accession: Q96IJ6, SwissProt: Q96IJ6 |
| Catalog # | NBP1-85904 |
| Price | |
| Order / More Info | GMPPA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 30072579 |