| Edit |   |
| Antigenic Specificity | GMPPA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GMPPA Antibody from Novus Biologicals is a rabbit polyclonal antibody to GMPPA. This antibody reacts with human. The GMPPA Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GMPPA(GDP-mannose pyrophosphorylase A) The peptide sequence was selected from the N terminal of GMPPA. Peptide sequence LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ. |
| Other Names | EC 2.7.7, EC 2.7.7.13, GDP-mannose pyrophosphorylase Amannose-1-phosphate guanyltransferase alpha, GTP-mannose-1-phosphate guanylyltransferase alpha, mannose-1-phosphate guanylyltransferase (GDP) |
| Gene, Accession # | GMPPA, Gene ID: 29926, Accession: Q96IJ6, SwissProt: Q96IJ6 |
| Catalog # | NBP1-55233 |
| Price | |
| Order / More Info | GMPPA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |