| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to S100A10. This antibody reacts with human. The S100A10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human S100A10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV |
|---|
| Other Names | annexin II ligand, calpactin I, light polypeptide, ANX2L, ANX2LG, CAL1LGP11,42C, Calpactin I light chain, Calpactin-1 light chain, Cellular ligand of annexin II, CLP11Ca[1], MGC111133, p10, p10 protein, p11, protein S100-A10, S100 calcium binding protein A10, S100 calcium binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11)), S100 calcium-binding protein A10, S100 calcium-binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11)) |
|---|
| Gene, Accession # | S100A10, Gene ID: 6281 |
|---|
| Catalog # | NBP1-89370 |
|---|
| Price | |
|---|
| Order / More Info | S100A10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|