| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A10 |
|---|
| Clone | 3E10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. It has been used for ELISA and WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A10 Antibody (3E10) from Novus Biologicals is a mouse monoclonal antibody to S100A10. This antibody reacts with human. The S100A10 Antibody (3E10) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | S100A10 (AAH15973, 1 a.a. - 97 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK |
|---|
| Other Names | annexin II ligand, calpactin I, light polypeptide, ANX2L, ANX2LG, CAL1LGP11,42C, Calpactin I light chain, Calpactin-1 light chain, Cellular ligand of annexin II, CLP11Ca[1], MGC111133, p10, p10 protein, p11, protein S100-A10, S100 calcium binding protein A10, S100 calcium binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11)), S100 calcium-binding protein A10, S100 calcium-binding protein A10 (annexin II ligand, calpactin I, lightpolypeptide (p11)) |
|---|
| Gene, Accession # | S100A10, Gene ID: 6281, Accession: AAH15973, SwissProt: AAH15973 |
|---|
| Catalog # | H00006281-M09 |
|---|
| Price | |
|---|
| Order / More Info | S100A10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|