| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to S100A11. This antibody reacts with human. The S100A11 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human S100A11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMK KLDTNSDGQLDFSEFLNLIGGLAMACHDSF |
|---|
| Other Names | calgizzarin, Metastatic lymph node gene 70 protein, MLN 70, MLN70, protein S100-A11, Protein S100-C, S100 calcium binding protein A11, S100 calcium-binding protein A11, S100 calcium-binding protein A11 (calgizzarin), S100CS100 calcium binding protein A11 (calgizzarin) |
|---|
| Gene, Accession # | S100A11, Gene ID: 6282 |
|---|
| Catalog # | NBP2-13270 |
|---|
| Price | |
|---|
| Order / More Info | S100A11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|