| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A11 |
|---|
| Clone | 1B12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A11 Antibody (1B12) from Novus Biologicals is a mouse monoclonal antibody to S100A11. This antibody reacts with human. The S100A11 Antibody (1B12) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | S100A11 (AAH14354.1, 10 a.a. - 87 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGL |
|---|
| Other Names | calgizzarin, Metastatic lymph node gene 70 protein, MLN 70, MLN70, protein S100-A11, Protein S100-C, S100 calcium binding protein A11, S100 calcium-binding protein A11, S100 calcium-binding protein A11 (calgizzarin), S100CS100 calcium binding protein A11 (calgizzarin) |
|---|
| Gene, Accession # | S100A11, Gene ID: 6282, Accession: AAH14354, SwissProt: AAH14354 |
|---|
| Catalog # | H00006282-M17 |
|---|
| Price | |
|---|
| Order / More Info | S100A11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|