| Edit |   |
|---|
| Antigenic Specificity | S100A13 |
|---|
| Clone | 3A7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A13 Antibody (3A7) from Novus Biologicals is a mouse monoclonal antibody to S100A13. This antibody reacts with human. The S100A13 Antibody (3A7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | S100A13 (NP_005970, 1 a.a. - 98 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK |
|---|
| Other Names | S100 calcium binding protein A13, S100 calcium-binding protein A13protein S100-A13 |
|---|
| Gene, Accession # | S100A13, Gene ID: 6284, Accession: NP_005970, SwissProt: NP_005970 |
|---|
| Catalog # | H00006284-M01 |
|---|
| Price | |
|---|
| Order / More Info | S100A13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|