| Edit |   |
|---|
| Antigenic Specificity | S100A3 |
|---|
| Clone | 1D4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A3 Antibody (1D4) from Novus Biologicals is a mouse monoclonal antibody to S100A3. This antibody reacts with human. The S100A3 Antibody (1D4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | S100A3 (NP_002951, 1 a.a. - 101 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ |
|---|
| Other Names | Protein S-100E, S100 calcium binding protein A3, S100 calcium-binding protein A3S100Eprotein S100-A3 |
|---|
| Gene, Accession # | S100A3, Gene ID: 6274, Accession: NP_002951, SwissProt: NP_002951 |
|---|
| Catalog # | H00006274-M01 |
|---|
| Price | |
|---|
| Order / More Info | S100A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|