| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A4 |
|---|
| Clone | 1F12-1G7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IF and ELISA. IHC was reported in scientific literature. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A4 Antibody (1F12-1G7) from Novus Biologicals is a mouse monoclonal antibody to S100A4. This antibody reacts with human, mouse. The S100A4 Antibody (1F12-1G7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | S100A4 (AAH16300, 1 a.a. - 101 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK |
|---|
| Other Names | 18A2, Calvasculin, CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, fibroblast-specific protein-1,42A, FSP1, leukemia multidrug resistance associated protein, malignant transformation suppression 1, Metastasin, MTS1, murine placental homolog), P9KA, PEL98, Placental calcium-binding protein, Protein Mts1, protein S100-A4, S100 calcium binding protein A4, S100 calcium-binding protein A4, S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) |
|---|
| Gene, Accession # | S100A4, Gene ID: 6275, Accession: AAH16300, SwissProt: AAH16300 |
|---|
| Catalog # | H00006275-M01 |
|---|
| Price | |
|---|
| Order / More Info | S100A4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17550972, 17974953, 21627981, 23239638, 23257286, 23262027, 23784029, 24067916, 24277698, 25527499, 28586644, 28641008, 28645539, 30635039 |
|---|
| 产品资料 |
|
|