| Edit |   |
|---|
| Antigenic Specificity | S100A5 |
|---|
| Clone | 5E1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A5 Antibody (5E1) from Novus Biologicals is a mouse monoclonal antibody to S100A5. This antibody reacts with human. The S100A5 Antibody (5E1) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | S100A5 (NP_002953, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEY |
|---|
| Other Names | Protein S-100D, S100 calcium binding protein A5, S100 calcium-binding protein A5S100Dprotein S100-A5 |
|---|
| Gene, Accession # | S100A5, Gene ID: 6276, Accession: NP_002953, SwissProt: NP_002953 |
|---|
| Catalog # | H00006276-M03 |
|---|
| Price | |
|---|
| Order / More Info | S100A5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|