| 产品详情 |
| Edit |   |
| Antigenic Specificity | IGFALS/ALS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IGFALS/ALS Antibody from Novus Biologicals is a rabbit polyclonal antibody to IGFALS/ALS. This antibody reacts with human. The IGFALS/ALS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IGFALS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAP |
| Other Names | ALS, ALS insulin-like growth factor binding protein complex acid labile chain, insulin-like growth factor binding protein, acid labile subunit, insulin-like growth factor-binding protein complex acid labile subunit |
| Gene, Accession # | IGFALS, Gene ID: 3483 |
| Catalog # | NBP1-89118 |
| Price | |
| Order / More Info | IGFALS/ALS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|