| Edit |   |
|---|
| Antigenic Specificity | S100A5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to S100A5. This antibody reacts with mouse. The S100A5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is S100a5 - middle region. Peptide sequence SLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDN. |
|---|
| Other Names | Protein S-100D, S100 calcium binding protein A5, S100 calcium-binding protein A5S100Dprotein S100-A5 |
|---|
| Gene, Accession # | S100A5, Gene ID: 6276, Accession: NP_035442 |
|---|
| Catalog # | NBP1-98577 |
|---|
| Price | |
|---|
| Order / More Info | S100A5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|