| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to S100A6. This antibody reacts with human, mouse, rat. The S100A6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat S100A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE |
|---|
| Other Names | 2A9, CABP, CACY5B10, calcyclin, Growth factor-inducible protein 2A9, MLN 4, PRAS100 calcium binding protein A6 (calcyclin), Prolactin receptor-associated protein, protein S100-A6, S100 calcium binding protein A6, S100 calcium-binding protein A6, S100 calcium-binding protein A6 (calcyclin) |
|---|
| Gene, Accession # | S100A6, Gene ID: 6277 |
|---|
| Catalog # | NBP1-89388 |
|---|
| Price | |
|---|
| Order / More Info | S100A6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26658462 |
|---|
| 产品资料 |
|
|