| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | S100A6 |
|---|
| Clone | 6B5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The S100A6 Antibody (6B5) from Novus Biologicals is a mouse monoclonal antibody to S100A6. This antibody reacts with human. The S100A6 Antibody (6B5) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | S100A6 (AAH01431, 1 a.a. - 90 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MACPLDRAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
|---|
| Other Names | 2A9, CABP, CACY5B10, calcyclin, Growth factor-inducible protein 2A9, MLN 4, PRAS100 calcium binding protein A6 (calcyclin), Prolactin receptor-associated protein, protein S100-A6, S100 calcium binding protein A6, S100 calcium-binding protein A6, S100 calcium-binding protein A6 (calcyclin) |
|---|
| Gene, Accession # | S100A6, Gene ID: 6277, Accession: AAH01431, SwissProt: AAH01431 |
|---|
| Catalog # | H00006277-M10 |
|---|
| Price | |
|---|
| Order / More Info | S100A6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21897749, 23257286, 23623205, 23993025 |
|---|
| 产品资料 |
|
|