| 产品详情 |
| Edit |   |
| Antigenic Specificity | YB1 |
| Clone | 4C7 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The YB1 Antibody (4C7) from Novus Biologicals is a mouse monoclonal antibody to YB1. This antibody reacts with human. The YB1 Antibody (4C7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Immunogen | YBX1 (NP_004550, 51 a.a. - 139 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA |
| Other Names | BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-binding protein 1, Y box binding protein 1, YB1 DNA-binding protein B, YB-1 Y-box transcription factor, YBX1 |
| Gene, Accession # | YBX1, Gene ID: 4904, Accession: NP_004550, SwissProt: NP_004550 |
| Catalog # | H00004904-M02 |
| Price | |
| Order / More Info | YB1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|