| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATPG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATPG Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATPG. This antibody reacts with human. The ATPG Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ATPG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASA |
|---|
| Other Names | ATP synthase gamma chain, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1, ATP5CATP synthase subunit gamma, mitochondrial, ATP5CL1mitochondrial ATP synthase, gamma subunit 1, F-ATPase gamma subunit |
|---|
| Gene, Accession # | ATP5C1, Gene ID: 509, Accession: P36542, SwissProt: P36542 |
|---|
| Catalog # | NBP2-34138 |
|---|
| Price | |
|---|
| Order / More Info | ATPG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|