| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KA2/GRIK5/Glutamate Receptor KA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KA2/GRIK5/Glutamate Receptor KA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KA2/GRIK5/Glutamate Receptor KA2. This antibody reacts with human. The KA2/GRIK5/Glutamate Receptor KA2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY |
|---|
| Other Names | EAA2, Excitatory amino acid receptor 2, glutamate receptor KA2, Glutamate receptor KA-2, glutamate receptor, ionotropic kainate 5, glutamate receptor, ionotropic, kainate 5, KA2GRIK2 |
|---|
| Gene, Accession # | GRIK5, Gene ID: 2901 |
|---|
| Catalog # | NBP2-68975 |
|---|
| Price | |
|---|
| Order / More Info | KA2/GRIK5/Glutamate Receptor KA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|