| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KA2/GRIK5/Glutamate Receptor KA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KA2/GRIK5/Glutamate Receptor KA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KA2/GRIK5/Glutamate Receptor KA2. This antibody reacts with human, mouse. The KA2/GRIK5/Glutamate Receptor KA2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human GRIK5. Peptide sequence EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM. |
|---|
| Other Names | EAA2, Excitatory amino acid receptor 2, glutamate receptor KA2, Glutamate receptor KA-2, glutamate receptor, ionotropic kainate 5, glutamate receptor, ionotropic, kainate 5, KA2GRIK2 |
|---|
| Gene, Accession # | GRIK5, Gene ID: 2901, Accession: NP_002079, SwissProt: NP_002079 |
|---|
| Catalog # | NBP1-80270 |
|---|
| Price | |
|---|
| Order / More Info | KA2/GRIK5/Glutamate Receptor KA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|