| 产品详情 |
| Edit |   |
| Antigenic Specificity | Kallikrein 1 |
| Clone | 3G2 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC-P usage reported in scientific literature (PMID: 26231762). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Kallikrein 1 Antibody (3G2) from Novus Biologicals is a mouse monoclonal antibody to Kallikrein 1. This antibody reacts with human. The Kallikrein 1 Antibody (3G2) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
| Immunogen | KLK1 (AAH05313 168 a.a. - 262 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS |
| Other Names | EC 3.4.21, EC 3.4.21.35, glandular kallikrein 1, hK1, kallikrein 1, kallikrein 1, renal/pancreas/salivary, kallikrein serine protease 1, kallikrein-1, Kidney/pancreas/salivary gland kallikrein, Klk6, KLKR, Tissue kallikrein |
| Gene, Accession # | KLK1, Gene ID: 3816, Accession: AAH05313, SwissProt: AAH05313 |
| Catalog # | H00003816-M01 |
| Price | |
| Order / More Info | Kallikrein 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26231762 |
| 产品资料 |
|
|