| 产品详情 |
| Edit |   |
| Antigenic Specificity | Cyr61/CCN1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 26681917). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cyr61/CCN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cyr61/CCN1. This antibody reacts with human. The Cyr61/CCN1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Cyr61/CCN1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV |
| Other Names | CCN family member 1, CCN1IGF-binding protein 10, Cysteine-rich angiogenic inducer 61, cysteine-rich, angiogenic inducer, 61, GIG1cysteine-rich heparin-binding protein 61, IBP-10, IGFBP-10, IGFBP10cysteine-rich, anigogenic inducer, 61, Insulin-like growth factor-binding protein 10, protein CYR61, Protein GIG1 |
| Gene, Accession # | CYR61, Gene ID: 3491 |
| Catalog # | NBP1-86573 |
| Price | |
| Order / More Info | Cyr61/CCN1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26681917 |
| 产品资料 |
|
|