| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCL21/6Ckine |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCL21/6Ckine Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCL21/6Ckine. This antibody reacts with human. The CCL21/6Ckine Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CCL21/6Ckine antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT |
|---|
| Other Names | 6CkineSmall-inducible cytokine A21, Beta-chemokine exodus-2, chemokine (C-C motif) ligand 21, CKb9, member 21, SCYA21MGC34555, secondary lymphoid tissue chemokine, SLCSecondary lymphoid-tissue chemokine |
|---|
| Gene, Accession # | CCL21, Gene ID: 6366, Accession: O00585, SwissProt: O00585 |
|---|
| Catalog # | NBP2-37928 |
|---|
| Price | |
|---|
| Order / More Info | CCL21/6Ckine Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25541736 |
|---|
| 产品资料 |
|
|