| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCL27/CTACK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCL27/CTACK Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCL27/CTACK. This antibody reacts with human. The CCL27/CTACK Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR |
|---|
| Other Names | ALP, C-C motif chemokine 27, chemokine (C-C motif) ligand 27, CTACKSmall-inducible cytokine A27, CTAK, cutaneous T-cell attracting chemokine, Cutaneous T-cell-attracting chemokine, ESKINE, IL-11 Ralpha-locus chemokine, ILCCC chemokine ILC, PESKY, SCYA27IL-11 R-alpha-locus chemokine, skinkine, small inducible cytokine subfamily A (Cys-Cys), member 27 |
|---|
| Gene, Accession # | CCL27, Gene ID: 10850 |
|---|
| Catalog # | NBP2-62684 |
|---|
| Price | |
|---|
| Order / More Info | CCL27/CTACK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|