| 产品详情 |
| Edit |   |
| Antigenic Specificity | Trypsin 1/PRSS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Trypsin 1/PRSS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Trypsin 1/PRSS1. This antibody reacts with human. The Trypsin 1/PRSS1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Trypsin 1/PRSS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RIQVRLGEHNIEVLEGNEQFINAAKIIRHP |
| Other Names | Beta-trypsin, Cationic trypsinogen, digestive zymogen, DKFZp779A0837, EC 3.4.21, EC 3.4.21.4, FLJ57296, MGC120175, MGC149362, nonfunctional trypsin 1, protease, serine, 1 (trypsin 1), Serine protease 1, TRP1, TRY1beta-trypsin, TRY4, TRYP1, Trypsin I, trypsin-1, trypsinogen 1, trypsinogen A |
| Gene, Accession # | PRSS1, Gene ID: 5644, Accession: P07477 |
| Catalog # | NBP2-46871 |
| Price | |
| Order / More Info | Trypsin 1/PRSS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|