| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Trypsin 3/PRSS3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Trypsin 3/PRSS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Trypsin 3/PRSS3. This antibody reacts with human. The Trypsin 3/PRSS3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PRSS3 (protease, serine, 3) The peptide sequence was selected from the N terminal of PRSS3. Peptide sequence VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH. |
|---|
| Other Names | Brain trypsinogen, EC 3.4.21, EC 3.4.21.4, Mesotrypsinogen, pancreatic trypsinogen III, protease, serine, 3, protease, serine, 3 (mesotrypsin), protease, serine, 4 (trypsin 4, brain), PRSS4, Serine protease 3, Serine protease 4, T9, TRY3MTG, TRY4mesotrypsin, trypsin 3, Trypsin III, Trypsin IV, trypsin-3, trypsinogen 4, trypsinogen 5, trypsinogen IV |
|---|
| Gene, Accession # | PRSS3, Gene ID: 5646, Accession: P35030, SwissProt: P35030 |
|---|
| Catalog # | NBP1-57036 |
|---|
| Price | |
|---|
| Order / More Info | Trypsin 3/PRSS3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|