| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AF4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AF4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AF4. This antibody reacts with human. The AF4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human AF4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK |
|---|
| Other Names | AF-4, AF4/FMR2 family member 1, AF4/FMR2 family, member 1, AF4myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 2, ALL1-fused gene from chromosome 4 protein, FEL, MLLT2MGC134969, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 2, PBM1, pre-B-cell monocytic leukemia partner 1, Protein AF-4, Protein FEL, Proto-oncogene AF4 |
|---|
| Gene, Accession # | AFF1, Gene ID: 4299 |
|---|
| Catalog # | NBP2-56873 |
|---|
| Price | |
|---|
| Order / More Info | AF4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|