| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GABARAPL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GABARAPL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GABARAPL1. This antibody reacts with human. The GABARAPL1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GABARAPL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TMGQLYEVMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPL TYGSVRL |
|---|
| Other Names | APG8L, APG8-LIKE, ATG8, ATG8B, ATG8L, Early estrogen-regulated protein, GABA(A) receptor-associated protein like 1, gamma-aminobutyric acid receptor-associated protein-like 1, gec1, GEC-1, GEC1GABA(A) receptor-associated protein-like 1, Glandular epithelial cell protein 1 |
|---|
| Gene, Accession # | GABARAPL1, Gene ID: 23710 |
|---|
| Catalog # | NBP2-14032 |
|---|
| Price | |
|---|
| Order / More Info | GABARAPL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|