| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PTGER4/EP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 29415894). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PTGER4/EP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTGER4/EP4. This antibody reacts with human, mouse. The PTGER4/EP4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse PTGER4/EP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMV |
|---|
| Other Names | EP4, EP4R, MGC126583, PGE receptor EP4 subtype, PGE receptor, EP4 subtype, PGE2 receptor EP4 subtype, prostaglandin E receptor 4 (subtype EP4), prostaglandin E2 receptor EP4 subtype, Prostanoid EP4 receptor, PTGER2 |
|---|
| Gene, Accession # | PTGER4, Gene ID: 5734, Accession: P35408, SwissProt: P35408 |
|---|
| Catalog # | NBP1-84833 |
|---|
| Price | |
|---|
| Order / More Info | PTGER4/EP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23227994, 29415894 |
|---|
| 产品资料 |
|
|