| Edit |   |
| Antigenic Specificity | GABA Receptor Epsilon |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GABA Receptor Epsilon Antibody from Novus Biologicals is a rabbit polyclonal antibody to GABA Receptor Epsilon. This antibody reacts with human. The GABA Receptor Epsilon Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human GABRE. Peptide sequence DVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDH. |
| Other Names | GABA(A) receptor subunit epsilon, gamma-aminobutyric acid (GABA) A receptor, epsilon, gamma-aminobutyric acid receptor subunit epsilon |
| Gene, Accession # | GABRE, Gene ID: 2564, Accession: NP_004952, SwissProt: NP_004952 |
| Catalog # | NBP1-80068-20ul |
| Price | |
| Order / More Info | GABA Receptor Epsilon Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |