| 产品详情 |
| Edit |   |
| Antigenic Specificity | Latrophilin 2/LPHN2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Latrophilin 2/LPHN2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Latrophilin 2/LPHN2. This antibody reacts with human. The Latrophilin 2/LPHN2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Latrophilin 2/LPHN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVKPVIGGSSSEDDAIVADASSLMHSDNPGLELHHKELEAPLIPQRTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHLQS |
| Other Names | Calcium-independent alpha-latrotoxin receptor 2, CIRL2, CIRL-2, CL2, KIAA0786, latrophilin 2, Latrophilin homolog 1, latrophilin homolog 2 (cow), latrophilin-2, LEC1LPHH1latrophilin 1, lectomedin-1 |
| Gene, Accession # | LPHN2, Gene ID: 23266 |
| Catalog # | NBP2-58704 |
| Price | |
| Order / More Info | Latrophilin 2/LPHN2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|