| 产品详情 |
| Edit |   |
| Antigenic Specificity | LATS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 29317530). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LATS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LATS1. This antibody reacts with human, rat. The LATS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LATS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSWEPNSQTKRYSGNMEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRP |
| Other Names | EC 2.7.11, h-warts, Large tumor suppressor homolog 1, LATS (large tumor suppressor, Drosophila) homolog 1, LATS, large tumor suppressor, homolog 1 (Drosophila), serine/threonine-protein kinase LATS1, WARTS protein kinase, WARTSEC 2.7.11.1, wts |
| Gene, Accession # | LATS1, Gene ID: 9113 |
| Catalog # | NBP1-86860 |
| Price | |
| Order / More Info | LATS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29317530 |
| 产品资料 |
|
|