| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LATS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LATS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LATS2. This antibody reacts with human. The LATS2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LATS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKSAKGDKGGKDK KQIQTSPVPVRKNSRDEEKR |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, FLJ13161, Kinase phosphorylated during mitosis protein, KPM, Large tumor suppressor homolog 2, LATS (large tumor suppressor, Drosophila) homolog 2, LATS, large tumor suppressor, homolog 2 (Drosophila), serine/threonine kinase KPM, Serine/threonine-protein kinase kpm, serine/threonine-protein kinase LATS2, Warts-like kinase |
|---|
| Gene, Accession # | LATS2, Gene ID: 26524 |
|---|
| Catalog # | NBP2-14184 |
|---|
| Price | |
|---|
| Order / More Info | LATS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|